Structure of PDB 7bk5 Chain AAA |
>7bk5AAA (length=97) Species: 216595 (Pseudomonas [fluorescens] SBW25) [Search protein sequence] |
HAHLKSATPAADSTVAAPADLRLTFSAGVEATFTKVSLSKDGTEVAIKGL ETPDADKKTLVVTPAAPLAAGNYKVVWNAVSVDTHKSNGEYSFKVGQ |
|
PDB | 7bk5 Copper binding and reactivity at the histidine brace motif: insights from mutational analysis of the Pseudomonas fluorescens copper chaperone CopC. |
Chain | AAA |
Resolution | 1.54 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
AAA |
H1 D83 H85 |
H1 D83 H85 |
|
|
|
|