Structure of PDB 7az0 Chain AAA

Receptor sequence
>7az0AAA (length=312) Species: 10090 (Mus musculus) [Search protein sequence]
GSHMRHRTLSSSPALWASIPCPRSELRLDLVLASGQSFRWKEQSPAHWSG
VLADQVWTLTQTEDQLYCTVYRGDDSQVSRPTLEELETLHKYFQLDVSLA
QLYSHWASVDSHFQRVAQKFQGVRLLRQDPTECLFSFICSSNNNIARITG
MVERLCQAFGPRLIQLDDVTYHGFPNLHALAGPEAETHLRKLGLGYRARY
VRASAKAILEEQGGPAWLQQLRVAPYEEAHKALCTLPGVGAKVADCICLM
ALDKPQAVPVDVHVWQIAHRDYGWHPKTGPSPLANKELGNFFRNLWGPYA
GWAQAVLFSADL
3D structure
PDB7az0 Small-molecule activation of OGG1 increases oxidative DNA damage repair by gaining a new function.
ChainAAA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SDW AAA G42 I155 K249 M257 D268 Q315 A316 F319 G35 I148 K242 M250 D261 Q304 A305 F308
Gene Ontology
Molecular Function
GO:0000702 oxidized base lesion DNA N-glycosylase activity
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0008017 microtubule binding
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016829 lyase activity
GO:0019104 DNA N-glycosylase activity
GO:0019899 enzyme binding
GO:0032357 oxidized purine DNA binding
GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0140097 catalytic activity, acting on DNA
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair
GO:0006355 regulation of DNA-templated transcription
GO:0006974 DNA damage response
GO:0006979 response to oxidative stress
GO:0009314 response to radiation
GO:0009410 response to xenobiotic stimulus
GO:0009416 response to light stimulus
GO:0032355 response to estradiol
GO:0034614 cellular response to reactive oxygen species
GO:0043066 negative regulation of apoptotic process
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0045471 response to ethanol
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051593 response to folic acid
GO:0071276 cellular response to cadmium ion
GO:1901291 negative regulation of double-strand break repair via single-strand annealing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0016363 nuclear matrix
GO:0016607 nuclear speck
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7az0, PDBe:7az0, PDBj:7az0
PDBsum7az0
PubMed35737787
UniProtO08760|OGG1_MOUSE N-glycosylase/DNA lyase (Gene Name=Ogg1)

[Back to BioLiP]