Structure of PDB 7ajr Chain AAA

Receptor sequence

>7ajrAAA (length=298) Species: 287 (Pseudomonas aeruginosa)

AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSK
TTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKL
YMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQN
SGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYM
DQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEV
FVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP

3D structure

• PDB: 7ajr Virtual Screening Approach to Identifying a Novel and Tractable Series of Pseudomonas aeruginosa Elastase Inhibitors.
• Chain: AAA
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H140 E141 H144 Y155 E164 D221 H223
• Catalytic site (residue number reindexed from 1): H140 E141 H144 Y155 E164 D221 H223
• Enzyme Commision number: 3.4.24.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RJB	AAA	E111 N112 F129 V137 H140 E141 H144 E164 I186 G187 I190 L197 R198 H223	E111 N112 F129 V137 H140 E141 H144 E164 I186 G187 I190 L197 R198 H223
BS02	ZN	AAA	H140 H144 E164	H140 H144 E164

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:7ajr, PDBe:7ajr, PDBj:7ajr
• PDBsum: 7ajr
• PubMed: 33603968
• UniProt: E3ULB4