Structure of PDB 6z6c Chain AAA

Receptor sequence

>6z6cAAA (length=315) Species: 330879 (Aspergillus fumigatus Af293)

MSTPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEK
NVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLG
GAKFQVAPYSCIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGT
NLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYP
DLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVCWDHGKG
YHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWN
RAHGSQLGRSALPPA

3D structure

• PDB: 6z6c Hexavalent thiofucosides to probe the role of the Aspergillus fumigatus lectin FleA in fungal pathogenicity.
• Chain: AAA
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Q9Q	AAA	S20 H23 R25 E37 E41 L69 Y88 W94	S20 H23 R25 E37 E41 L69 Y88 W94
BS02	Q9Q	AAA	R73 E85 G97 G98 L123 L125 W141 W146	R73 E85 G97 G98 L123 L125 W141 W146
BS03	Q9Q	AAA	R126 E138 N142 T150 I176 Y192 W198	R126 E138 N142 T150 I176 Y192 W198
BS04	Q9Q	AAA	R230 Q242 D253 L281 W299	R230 Q242 D253 L281 W299
BS05	Q9Q	AAA	Y40 R282 E296	Y40 R282 E296

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding
• GO:0046872 metal ion binding

Biological Process

• GO:0008150 biological_process

External links

• PDB: RCSB:6z6c, PDBe:6z6c, PDBj:6z6c
• PDBsum: 6z6c
• PubMed: 33885578
• UniProt: Q4WW81|LECF_ASPFU Fucose-specific lectin (Gene Name=fleA)