Structure of PDB 6vho Chain AAA

Receptor sequence
>6vhoAAA (length=237) Species: 411476 (Bacteroides ovatus ATCC 8483) [Search protein sequence]
ILFKDDFNFFDEKVWTKETHEPGWTNQELQAYDAAHVSVGKDGDKSVLIL
TAERKGNKIYSGRINSKGKKSFKYRKIEASIKLPKTNGGLWPAFWMMGDN
DKQWPACGEIDIMEMGEQSGMAAGDSEKQVNTAIHYGPSAAAHEQQYYKA
NVANSLQDGNYHTYSLDWDENNLTISIDNVKFHTFDISSNTYFHDNFYIL
FNLAVGGAFTGITDINKLTGLKDGQKVNMYIDWVKIL
3D structure
PDB6vho Orthogonal Active-Site Labels for Mixed-Linkage endo-beta-Glucanases.
ChainAAA
Resolution2.148 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NBG AAA N60 W125 A127 W129 E143 D145 E148 H169 F243 N26 W91 A93 W95 E109 D111 E114 H135 F209
BS02 BGC AAA N60 M131 W138 N26 M97 W104
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Feb 23 04:01:33 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6vho', asym_id = 'AAA', title = 'Orthogonal Active-Site Labels for Mixed-Linkage endo-beta-Glucanases.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6vho', asym_id='AAA', title='Orthogonal Active-Site Labels for Mixed-Linkage endo-beta-Glucanases.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004553,0005975', uniprot = '', pdbid = '6vho', asym_id = 'AAA'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004553,0005975', uniprot='', pdbid='6vho', asym_id='AAA')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>