Structure of PDB 6tn0 Chain AAA

Receptor sequence
>6tn0AAA (length=341) Species: 9606 (Homo sapiens) [Search protein sequence]
GSAPKYIEHFSKFSPSPLSMKQFLDFGSACEKTSFTFLRQELPVRLANIM
KEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDA
LVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISI
RMLINQHTLIFDKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLE
IQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPI
KVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPPLAGYGLPISR
LYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYN
3D structure
PDB6tn0 Rapid optimisation of fragments and hits to lead compounds from screening of crude reaction mixtures
ChainAAA
Resolution1.905 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H239 E243 K246 N247
Catalytic site (residue number reindexed from 1) H224 E228 K231 N232
Enzyme Commision number 2.7.11.2: [pyruvate dehydrogenase (acetyl-transferring)] kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TF3 AAA P64 V67 Y129 N142 I143 P57 V60 Y122 N135 I136 BindingDB: IC50=2000nM
BS02 NLZ AAA N247 D282 V287 T346 N232 D267 V272 T320
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004740 pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006006 glucose metabolic process
GO:0006111 regulation of gluconeogenesis
GO:0006885 regulation of pH
GO:0008286 insulin receptor signaling pathway
GO:0010510 regulation of acetyl-CoA biosynthetic process from pyruvate
GO:0010565 regulation of cellular ketone metabolic process
GO:0010906 regulation of glucose metabolic process
GO:0016310 phosphorylation
GO:0031670 cellular response to nutrient
GO:0034614 cellular response to reactive oxygen species
GO:0042593 glucose homeostasis
GO:0050848 regulation of calcium-mediated signaling
GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol
GO:0045254 pyruvate dehydrogenase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tn0, PDBe:6tn0, PDBj:6tn0
PDBsum6tn0
PubMed
UniProtQ15119|PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial (Gene Name=PDK2)

[Back to BioLiP]