Structure of PDB 6ss4 Chain AAA

Receptor sequence

>6ss4AAA (length=316) Species: 9606 (Homo sapiens) [Search protein sequence]

MVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDL
SFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHS
LAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLREL
QDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRD
IDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGL
TYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIAS
SFGQTREGGHIVYDQL

3D structure

PDB

6ss4 Structural and functional characterization of C0021158, a high-affinity monoclonal antibody that inhibits Arginase 2 function via a novel non-competitive mechanism of action.

Chain

AAA

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.5.3.1: arginase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	AAA	H120 D143 D147 D251	H99 D122 D126 D230
BS02	MN	AAA	D143 H145 D251 D253	D122 H124 D230 D232

Gene Ontology

	Molecular Function
GO:0004053	arginase activity
GO:0005515	protein binding
GO:0016787	hydrolase activity
GO:0016813	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
GO:0030145	manganese ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0000050	urea cycle
GO:0001657	ureteric bud development
GO:0002250	adaptive immune response
GO:0002829	negative regulation of type 2 immune response
GO:0006525	arginine metabolic process
GO:0006809	nitric oxide biosynthetic process
GO:0006941	striated muscle contraction
GO:0019547	arginine catabolic process to ornithine
GO:0032651	regulation of interleukin-1 beta production
GO:0032696	negative regulation of interleukin-13 production
GO:0032700	negative regulation of interleukin-17 production
GO:0032720	negative regulation of tumor necrosis factor production
GO:0045087	innate immune response
GO:0071641	negative regulation of macrophage inflammatory protein 1 alpha production
GO:0071644	negative regulation of chemokine (C-C motif) ligand 4 production
GO:0071650	negative regulation of chemokine (C-C motif) ligand 5 production
GO:1900425	negative regulation of defense response to bacterium
GO:1903426	regulation of reactive oxygen species biosynthetic process
GO:1905403	negative regulation of activated CD8-positive, alpha-beta T cell apoptotic process
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation
GO:2000774	positive regulation of cellular senescence

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ss4, PDBe:6ss4, PDBj:6ss4
PDBsum	6ss4
PubMed	32880207
UniProt	P78540\|ARGI2_HUMAN Arginase-2, mitochondrial (Gene Name=ARG2)

[Back to BioLiP]