Structure of PDB 6sg2 Chain AAA

Receptor sequence

>6sg2AAA (length=396) Species: 876 (Desulfovibrio desulfuricans)

SRTVMERIEYEMHTPDPKADPDKLHFVQIDEAKCIGCDTCSQYCPTAAIF
GEMGEPHSIPHIEACINCGQCLTHCPENAIYEAQSWVPEVEKKLKDGKVK
CIAMPAPAVRYALGDAFGMPVGSVTTGKMLAALQKLGFAHCWDTEFTADV
TIWEEGSEFVERLTKKSDMPLPQFTSCCPGWQKYAETYYPELLPHFSTCK
SPIGMNGALAKTYGAERMKYDPKQVYTVSIMPCIAKKYEGLRPELKSSGM
RDIDATLTTRELAYMIKKAGIDFAKLPDGKRDSLMGESTGGATIFGVTGG
VMEAALRFAYEAVTGKKPDSWDFKAVRGLDGIKEATVNVGGTDVKVAVVH
GAKRFKQVCDDVKAGKSPYHFIEYMACPGGCVCGGGQPVMPGVLEA

3D structure

• PDB: 6sg2 Caught in the H inact : Crystal Structure and Spectroscopy Reveal a Sulfur Bound to the Active Site of an O 2 -stable State of [FeFe] Hydrogenase.
• Chain: AAA
• Resolution: 1.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	AAA	C179 C234 M376 A377 C378 C382	C178 C233 M375 A376 C377 C381
BS02	SF4	AAA	C45 P46 I50 I60 C66 I67 N68 C69 G70 C72	C44 P45 I49 I59 C65 I66 N67 C68 G69 C71
BS03	SF4	AAA	C35 I36 G37 C38 D39 C41 H58 C76 E78 I81	C34 I35 G36 C37 D38 C40 H57 C75 E77 I80
BS04	LFH	AAA	A107 P108 A109 C178 P203 I204 M232 P233 K237 F296 M376 C382	A106 P107 A108 C177 P202 I203 M231 P232 K236 F295 M375 C381

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat May 10 23:03:37 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6sg2', asym_id = 'AAA', title = 'Caught in the H inact : Crystal Structure and Sp...e of an O 2 -stable State of [FeFe] Hydrogenase. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6sg2', asym_id='AAA', title='Caught in the H inact : Crystal Structure and Sp...e of an O 2 -stable State of [FeFe] Hydrogenase. ')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0005506,0008901,0051536', uniprot = '', pdbid = '6sg2', asym_id = 'AAA'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005506,0008901,0051536', uniprot='', pdbid='6sg2', asym_id='AAA')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>