Structure of PDB 8q5i Chain AA

Receptor sequence
>8q5iAA (length=135) Species: 5476 (Candida albicans) [Search protein sequence]
AKFIKSGKVAIVVRGRYAGKKVVIVKPHDEGTKSHPFPHAIVAGIERAPL
KVTKKMDAKKVTKRTKVKPFVKLVNYNHLMPTRYSLDVESFKSAVTSEAL
EEPSQREEAKKVVKKAFEEKHQAGKNKWFFQKLHF
3D structure
PDB8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
ChainAA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AA G16 R17 H36 F38 R48 K52 T54 K55 K61 K64 R65 K69 K73 L74 N76 H79 R107 E108 K111 K115 K133 H135 F136 G15 R16 H35 F37 R47 K51 T53 K54 K60 K63 R64 K68 K72 L73 N75 H78 R106 E107 K110 K114 K132 H134 F135
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum8q5i
PubMed
UniProtQ9P843|RL27_CANAX Large ribosomal subunit protein eL27 (Gene Name=RPL27)

[Back to BioLiP]