Structure of PDB 7q9c Chain AA

Receptor sequence
>7q9cAA (length=221) Species: 9606 (Homo sapiens) [Search protein sequence]
LPKSVDWRKKGYVTPVKNQKQCGSAWAFSATGALEGQMFRKTGKLVSLSE
QNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKY
RPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSG
IYFEPDCSSKNLDHGVLVVGYGFEGANSQNSKYWLVKNSWGPEWGSNGYV
KIAKDKNNHCGIATAASYPNV
3D structure
PDB7q9c Proteomic data and structure analysis combined reveal interplay of structural rigidity and flexibility on selectivity of cysteine cathepsins.
ChainAA
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide AA A25 G67 G68 F69 M70 D163 H164 A25 G67 G68 F69 M70 D163 H164
BS02 peptide AA Q19 K20 Q145 H164 W190 Q19 K20 Q145 H164 W190
BS03 TFA AA E120 K121 K182 K204 D205 E120 K121 K182 K204 D205
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 14:10:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7q9c', asym_id = 'AA', title = 'Proteomic data and structure analysis combined r...exibility on selectivity of cysteine cathepsins. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7q9c', asym_id='AA', title='Proteomic data and structure analysis combined r...exibility on selectivity of cysteine cathepsins. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006508,0008234', uniprot = '', pdbid = '7q9c', asym_id = 'AA'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006508,0008234', uniprot='', pdbid='7q9c', asym_id='AA')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>