Structure of PDB 6fsz Chain AA

Receptor sequence

>6fszAA (length=299) Species: 559292 (Saccharomyces cerevisiae S288C)

KDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMG
NTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEV
LCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASC
IAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFN
PQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAG
GLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSEN

3D structure

• PDB: 6fsz Structure of the nuclear exosome captured on a maturing preribosome.
• Chain: AA
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AA	Y68 D70	Y66 D68

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0035925 mRNA 3'-UTR AU-rich region binding

Biological Process

• GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
• GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006401 RNA catabolic process
• GO:0034473 U1 snRNA 3'-end processing
• GO:0034475 U4 snRNA 3'-end processing
• GO:0034476 U5 snRNA 3'-end processing
• GO:0071028 nuclear mRNA surveillance
• GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
• GO:0071038 TRAMP-dependent tRNA surveillance pathway

Cellular Component

• GO:0000176 nuclear exosome (RNase complex)
• GO:0000177 cytoplasmic exosome (RNase complex)
• GO:0000178 exosome (RNase complex)
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:6fsz, PDBe:6fsz, PDBj:6fsz
• PDBsum: 6fsz
• PubMed: 29519915
• UniProt: Q05636|RRP45_YEAST Exosome complex component RRP45 (Gene Name=RRP45)