Structure of PDB 5lzt Chain AA

Receptor sequence
>5lztAA (length=217) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINL
KRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAG
RFTPGTFTNQIQTAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTD
SPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL
YFYRDPEEIEKEEQAAA
3D structure
PDB5lzt Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
ChainAA
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AA F32 R41 R102 T104 P105 G106 T109 N110 I112 Q113 Q132 E136 Y139 R155 F31 R40 R101 T103 P104 G105 T108 N109 I111 Q112 Q131 E135 Y138 R154
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:35:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5lzt', asym_id = 'AA', title = 'Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5lzt', asym_id='AA', title='Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005055,0005840,0006412,0015935', uniprot = '', pdbid = '5lzt', asym_id = 'AA'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005055,0005840,0006412,0015935', uniprot='', pdbid='5lzt', asym_id='AA')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>