Structure of PDB 5b5m Chain AA

Receptor sequence
>5b5mAA (length=60) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
FTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNI
PVSYQALGKK
3D structure
PDB5b5m Structural Basis for the Unusual Qy Red-Shift and Enhanced Thermostability of the LH1 Complex from Thermochromatium tepidum.
ChainAA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRT AA M37 I38 M36 I37
BS02 CRT AA L33 H36 L32 H35
BS03 BCL AA Q28 H36 W46 Q27 H35 W45
BS04 BCL AA G32 H36 G31 H35
BS05 CRT AA L21 I24 F27 Q28 L31 I38 L20 I23 F26 Q27 L30 I37
BS06 CRT AA K10 I11 I14 K9 I10 I13
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b5m, PDBe:5b5m, PDBj:5b5m
PDBsum5b5m
PubMed27933779
UniProtD2Z0P2

[Back to BioLiP]