Structure of PDB 4wr6 Chain AA

Receptor sequence
>4wr6AA (length=82) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVY
NGKQHVPVYITENMVGHKLGEFAPTRTYRGHG
3D structure
PDB4wr6 Structural insights into the translational infidelity mechanism.
ChainAA
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AA R3 S4 K6 F10 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 T79 Y80 R81 H83 G84 R1 S2 K4 F8 H12 W32 R34 R35 Y50 N51 G52 K53 K68 G70 E71 T75 T77 Y78 R79 H81 G82
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4wr6, PDBe:4wr6, PDBj:4wr6
PDBsum4wr6
PubMed26037619
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]