Structure of PDB 8ova Chain A9

Receptor sequence
>8ovaA9 (length=69) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
KVFTKPKKPIHRHKLEKMRALKYFKVTENSFKVERTRDECPNPNCGAGVF
MAQHKGRKYCGKCHLTYTM
3D structure
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainA9
Resolution2.47 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A9 F83 K88 P89 H91 R92 H93 L95 K97 M98 R99 R120 F133 A135 H137 R140 Y142 G144 K145 H147 T149 F3 K8 P9 H11 R12 H13 L15 K17 M18 R19 R37 F50 A52 H54 R57 Y59 G61 K62 H64 T66
BS02 ZN A9 C123 C143 C146 C40 C60 C63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ57WI3

[Back to BioLiP]