Structure of PDB 8ova Chain A8

Receptor sequence

>8ovaA8 (length=56) Species: 5702 (Trypanosoma brucei brucei)

GHLHQWRSRQKIGMGKGSRHCVICSNQKALIRKYELNVCRQCFRENAENI
GFVKLR

3D structure

• PDB: 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: A8
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A8	G2 H3 H5 Q6 W7 R10 Q11 M15 K17 G18 R20 C25 N27 K29 A30 R33 R41 Q42 R45 E46 K55 R57	G1 H2 H4 Q5 W6 R9 Q10 M14 K16 G17 R19 C24 N26 K28 A29 R32 R40 Q41 R44 E45 K54 R56

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 06:26:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ova', asym_id = 'A8', title = 'A single pseudouridine on rRNA regulates ribosom...ion in the mammalian parasite Trypanosoma brucei.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ova', asym_id='A8', title='A single pseudouridine on rRNA regulates ribosom...ion in the mammalian parasite Trypanosoma brucei.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '8ova', asym_id = 'A8'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='8ova', asym_id='A8')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>