Structure of PDB 4wra Chain A8

Receptor sequence

>4wraA8 (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

3D structure

PDB

4wra Structural insights into the translational infidelity mechanism.

Chain

Resolution

3.05 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A8	R3 R9 F12 R13 N16 R17 R20 T21 R23 F87 R89 Y94 E111 F112	R1 R7 F10 R11 N14 R15 R18 T19 R21 F85 R87 Y92 E109 F110
BS02	rna	A8	R15 R25 F29 R30 S31 L32 H34 Y36 Q38 G45 V46 T47 S50 L54 A55 N61 K62 T63 K93 H95 R97	R13 R23 F27 R28 S29 L30 H32 Y34 Q36 G43 V44 T45 S48 L52 A53 N59 K60 T61 K91 H93 R95

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4wra, PDBe:4wra, PDBj:4wra
PDBsum	4wra
PubMed	26037619
UniProt	Q5SHQ4\|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)