Structure of PDB 4v4p Chain A8

Receptor sequence

>4v4pA8 (length=63) Species: 300852 (Thermus thermophilus HB8)

PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLA
KAEWARMKLMLPR

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: A8
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A8	P2 K3 M4 K5 H7 K8 K11 R12 R13 T17 T19 F25 S27 G28 K29 R30 H31 Q32 N33 G35 I41 R42 K46 V49 K52 W55 M61 L62	P1 K2 M3 K4 H6 K7 K10 R11 R12 T16 T18 F24 S26 G27 K28 R29 H30 Q31 N32 G34 I40 R41 K45 V48 K51 W54 M60 L61

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 09:19:54 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'A8', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='A8', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4p', asym_id = 'A8'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4p', asym_id='A8')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>