Structure of PDB 3jbp Chain A8

Receptor sequence

>3jbpA8 (length=125) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

AVKKVGKIIKKRTKKFTRFQSNRFMRVKPAWRKPRGIDCRVRRRYKGTNL
MPSIGYGSNKKTKFLLPNNKYKYVVKNVKEMEPLIMNHTKYCVQIAHNVS
SKKRKQIIERAKQMNVSVINAKARL

3D structure

PDB

3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

6.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A8	A2 K4 K11 K12 R13 K15 K16 F17 R19 F20 Q21 N23 R24 F25 M26 R27 V28 K29 W32 R33 K34 R36 G37 I38 C40 R41 R43 R44 R45 Y46 K47 G48 S54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 L67 P68 N69 K71 K73 K77 N78 T90 Q95 A97 H98 N99 V100 S101 S102 K103 K104 R105 K113 S118 I120 A124 R125	A1 K3 K10 K11 R12 K14 K15 F16 R18 F19 Q20 N22 R23 F24 M25 R26 V27 K28 W31 R32 K33 R35 G36 I37 C39 R40 R42 R43 R44 Y45 K46 G47 S53 I54 G55 Y56 G57 S58 N59 K60 K61 K63 L66 P67 N68 K70 K72 K76 N77 T89 Q94 A96 H97 N98 V99 S100 S101 K102 K103 R104 K112 S117 I119 A123 R124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links