Structure of PDB 4v4p Chain A7

Receptor sequence
>4v4pA7 (length=46) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSD
3D structure
PDB4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
ChainA7
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna A7 M1 R3 T4 Y5 Q6 P7 N8 N9 R10 K11 R12 A13 K14 H16 G17 F18 R19 M22 K25 S26 I30 R34 R35 G38 R39 H40 V44 M1 R3 T4 Y5 Q6 P7 N8 N9 R10 K11 R12 A13 K14 H16 G17 F18 R19 M22 K25 S26 I30 R34 R35 G38 R39 H40 V44
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Mar 9 08:48:36 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'A7', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='A7', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4p', asym_id = 'A7'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4p', asym_id='A7')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>