Structure of PDB 8ove Chain A6

Receptor sequence

>8oveA6 (length=178) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVNMTLSK
MRRTARLLLTLPENHPRRLLEGSAIMRRCHGYGFLDEDKDKLDYVLSLTV
PDILERRLQTVVFKHGLAKSVHHSRVLIQQRHIAVAKQIVTIPSFIVRVS
SEHHIAFADASPFGNGRPGRVKRVKRNA

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A6	M1 R2 N3 Y4 N5 N6 F7 N8 R9 V10 R15 R16 F18 K20 R36 K38 R39 R43 E71 K119 S120 H123 Q130 R131 H132 V140 T141 I142 S144 F145 R148 G169 R170 V171 K172 R173	M1 R2 N3 Y4 N5 N6 F7 N8 R9 V10 R15 R16 F18 K20 R36 K38 R39 R43 E71 K119 S120 H123 Q130 R131 H132 V140 T141 I142 S144 F145 R148 G169 R170 V171 K172 R173

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:0031981	nuclear lumen
GO:0043226	organelle
GO:0097014	ciliary plasm
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	P17959\|RS9_TRYBB Small ribosomal subunit protein uS4

[Back to BioLiP]