Structure of PDB 4v87 Chain A6

Receptor sequence
>4v87A6 (length=45) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVK
3D structure
PDB4v87 A new understanding of the decoding principle on the ribosome.
ChainA6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A6 R18 R19 Y21 T23 E24 K25 K27 R28 P31 R37 K38 Y39 W42 K45 H46 R10 R11 Y13 T15 E16 K17 K19 R20 P23 R29 K30 Y31 W34 K37 H38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v87, PDBe:4v87, PDBj:4v87
PDBsum4v87
PubMed22437501
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]