Structure of PDB 8ove Chain A5

Receptor sequence

>8oveA5 (length=186) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

GIVRSRLHKRKITGGKTKIHRKRMKAELGRLPANTKLGPRRVSPVRARGG
NFKLRGLRLDTGNFAWGTEASAQRARILDVVYNATSNELVRTKTLVKNCI
VVVDAAPFRLWYAKHYGIDLDVKKASSKLKRKWEYRRKHHKIEKALADQL
REGRLLARITSRPGQTGRADGALLEGAELQFYLKKL

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	A5	G2 R5 R7 K10 R11 K12 T14 H21 R22 K23 R24 M25 K26 L29 R31 P33 A34 R42 R47 R49 G50 L55 R56 N64 A66 A73 Q74 T86 K98 K153 S155 T189 R191 Q194 D199	G1 R4 R6 K9 R10 K11 T13 H20 R21 K22 R23 M24 K25 L28 R30 P32 A33 R41 R46 R48 G49 L54 R55 N63 A65 A72 Q73 T85 K97 K124 S126 T160 R162 Q165 D170
BS02	rna	A5	R77 R92 R183	R76 R91 R154
BS03	MG	A5	G63 F65 A198 D199	G62 F64 A169 D170

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0042301	phosphate ion binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q57YL6

[Back to BioLiP]