Structure of PDB 4v4p Chain A5

Receptor sequence
>4v4pA5 (length=58) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGY
YDGRQVLA
3D structure
PDB4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
ChainA5
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A5 A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 S14 K15 R16 M18 R19 R20 S21 H22 N29 T31 H43 A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 S13 K14 R15 M17 R18 R19 S20 H21 N28 T30 H42
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Mar 9 09:25:02 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'A5', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='A5', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0006412,0015934', uniprot = '', pdbid = '4v4p', asym_id = 'A5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0006412,0015934', uniprot='', pdbid='4v4p', asym_id='A5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>