Structure of PDB 4v4n Chain A5

Receptor sequence

>4v4nA5 (length=81) Species: 2190 (Methanocaldococcus jannaschii)

AIDVGRIAVVIAGRRAGQKVVVVDIIDKNFVLVTGAGLNKVKRRRMNIKH
IEPLPQKIDIPRGASDEEVRAALEKAGISLA

3D structure

• PDB: 4v4n Structure of the SecY channel during initiation of protein translocation.
• Chain: A5
• Resolution: 9.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A5	A14 G15 R16 R17 N31 K42 K44 R46 R47 M48 N49 K51	A12 G13 R14 R15 N29 K40 K42 R44 R45 M46 N47 K49

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 08:42:19 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'A5', title = 'Structure of the SecY channel during initiation of protein translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='A5', title='Structure of the SecY channel during initiation of protein translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '4v4n', asym_id = 'A5'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='4v4n', asym_id='A5')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>