Structure of PDB 3jbn Chain A5

Receptor sequence

>3jbnA5 (length=223) Species: 36329 (Plasmodium falciparum 3D7)

AAKKIKTLKLINKKKRNDLRQRTLRYEEEYESERKKIIELKREARKNNCF
YREAEKKVVFVIRLKGVNKLPPKVRSVFRLLRLLQVHNGVFVKVNKATKE
MLKIVEPYVTYGYPTLSTVRKLLYKRGYVRVGKVRRYARKKIQDNADISK
HLGKYNVHGIEDMVYQLYTCGPVFKKVNNFLWAFKLKPPRKGFKAKRHAF
NEPRPGDWGNREAHINELINRMI

3D structure

• PDB: 3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
• Chain: A5
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A5	K43 K47 R50 R54 R68 I72 R76 R79 K99 G100 V101 N102 K103 P106 K107 R109 S110 R113 L114 R116 L118 Q119 V120 K127 K130 A131 T149 S151 K159 R160 Y162 R164 K167 V168 R169 R170 Y171 A172 R173 K174 H185 Y189 V207 K209 K210 N213 F214 W216 K219 L220 K221 P222 P223 R224 K225 G226 F227 K228 A229 K230 R231	K9 K13 R16 R20 R34 I38 R42 R45 K65 G66 V67 N68 K69 P72 K73 R75 S76 R79 L80 R82 L84 Q85 V86 K93 K96 A97 T115 S117 K125 R126 Y128 R130 K133 V134 R135 R136 Y137 A138 R139 K140 H151 Y155 V173 K175 K176 N179 F180 W182 K185 L186 K187 P188 P189 R190 K191 G192 F193 K194 A195 K196 R197
BS02	rna	A5	E140 R231 H232 N235 R238	E106 R197 H198 N201 R204

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

External links

• PDB: RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
• PDBsum: 3jbn
• PubMed: 26432834
• UniProt: O97250