Structure of PDB 4v9q Chain A4

Receptor sequence

>4v9qA4 (length=48) Species: 262724 (Thermus thermophilus HB27)

MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK

3D structure

• PDB: 4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
• Chain: A4
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A4	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 T15 H16 G17 F18 R19 R21 G27 K29 V30 R33 R34 K37 G38 R39 W40 R41 R47 K48	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 T15 H16 G17 F18 R19 R21 G27 K29 V30 R33 R34 K37 G38 R39 W40 R41 R47 K48
BS02	MG	A4	G17 T43	G17 T43
BS03	MG	A4	K32 Q36	K32 Q36
BS04	MG	A4	K14 A20	K14 A20

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
• PDBsum: 4v9q
• PubMed: 23824292
• UniProt: P80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)