Structure of PDB 4v7k Chain A4 |
>4v7kA4 (length=57) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVE |
|
PDB | 4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE. |
Chain | A4 |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A4 |
M1 K2 E3 H6 |
M1 K2 E3 H6 |
|
|
|
|