Structure of PDB 4v4p Chain A4

Receptor sequence

>4v4pA4 (length=73) Species: 300852 (Thermus thermophilus HB8)

MQKDLHPKAVPCKIIYQGQVVMETMSTRPEIHVDVWSGVHPFWTGEERFL
DTEGRVDKFNKRFGDSYRRGSKK

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: A4
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A4	M1 Q2 K3 V10 I15 Y16 E23 T24 S26 T27 R28 P29 E30 I31 H32 V33 D34 V35 G38 V39 H40 P41 F42 W43 R55 K58 F59 R62 F63 R69	M1 Q2 K3 V10 I15 Y16 E23 T24 S26 T27 R28 P29 E30 I31 H32 V33 D34 V35 G38 V39 H40 P41 F42 W43 R55 K58 F59 R62 F63 R69

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 09:02:05 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'A4', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='A4', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4p', asym_id = 'A4'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4p', asym_id='A4')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>