Structure of PDB 7qi5 Chain A3

Receptor sequence

>7qi5A3 (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]

KNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIW
LKAGLKEAPEGWQTPKIYLR

3D structure

PDB

7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

Chain

Resolution

2.63 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A3	K128 V130 L131 K132 I133 R134 R136 K137 M138 N139 H140 H141 K142 Y143 R144 K145 V147 K148 R151 R155 R161 R164 K165 R175 R197	K1 V3 L4 K5 I6 R7 R9 K10 M11 N12 H13 H14 K15 Y16 R17 K18 V20 K21 R24 R28 R34 R37 K38 R48 R70
BS02	rna	A3	F152 K156 E159 R197	F25 K29 E32 R70

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0032543	mitochondrial translation
GO:0045839	negative regulation of mitotic nuclear division
GO:0045862	positive regulation of proteolysis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0043231	intracellular membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum	7qi5
PubMed	38769321
UniProt	Q9NWT8\|AKIP_HUMAN Small ribosomal subunit protein mS38 (Gene Name=AURKAIP1)