Structure of PDB 7og4 Chain A3

Receptor sequence
>7og4A3 (length=69) Species: 9606 (Homo sapiens) [Search protein sequence]
KNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIW
LKAGLKEAPEGWQTPKIYL
3D structure
PDB7og4 Structural basis of mitochondrial translation.
ChainA3
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A3 K128 N129 L131 K132 I133 R134 R136 K137 M138 N139 H141 K142 Y143 R144 K145 L146 V147 K148 R151 R155 R161 R164 K165 K171 Y195 K1 N2 L4 K5 I6 R7 R9 K10 M11 N12 H14 K15 Y16 R17 K18 L19 V20 K21 R24 R28 R34 R37 K38 K44 Y68
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
GO:0045839 negative regulation of mitotic nuclear division
GO:0045862 positive regulation of proteolysis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0043231 intracellular membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7og4, PDBe:7og4, PDBj:7og4
PDBsum7og4
PubMed32812867
UniProtQ9NWT8|AKIP_HUMAN Small ribosomal subunit protein mS38 (Gene Name=AURKAIP1)

[Back to BioLiP]