Structure of PDB 4v8y Chain A3

Receptor sequence

>4v8yA3 (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR

3D structure

PDB

4v8y Molecular architecture of a eukaryotic translational initiation complex.

Chain

Resolution

4.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	A3	W7 F8 S9 H10 R12 R13 Y14 G15 K16 G17 R19 C24 S26 G29 L30 I31 R32 K33 Y34 R40 Q41 C42 R44 E45 K54 F55 R56	W4 F5 S6 H7 R9 R10 Y11 G12 K13 G14 R16 C21 S23 G26 L27 I28 R29 K30 Y31 R37 Q38 C39 R41 E42 K51 F52 R53
BS02	ZN	A3	C21 C24 C39 C42	C18 C21 C36 C39
BS03	OHX	A3	S25 H27	S22 H24
BS04	MG	A3	N5 W7	N2 W4
BS05	MG	A3	S26 C39	S23 C36

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum	4v8y
PubMed	24200810
UniProt	P41057\|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)