Structure of PDB 4v8e Chain A3

Receptor sequence

>4v8eA3 (length=76) Species: 300852 (Thermus thermophilus HB8)

TRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v8e A new understanding of the decoding principle on the ribosome.
• Chain: A3
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A3	N12 R14 D15 S16 Q17 A18 K19 R20 V23 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 F60 F69 L75 R77	N3 R5 D6 S7 Q8 A9 K10 R11 V14 K15 R16 Y17 E18 Q20 R23 A24 G25 N26 I27 R30 R32 G33 T34 G45 R46 D47 F48 F51 F60 L66 R68
BS02	rna	A3	R72 R74	R63 R65
BS03	OHX	A3	E27 F69	E18 F60

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8e, PDBe:4v8e, PDBj:4v8e
• PDBsum: 4v8e
• PubMed: 22437501
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)