Structure of PDB 7dgq Chain A2 |
>7dgqA2 (length=106) Species: 9913 (Bos taurus) [Search protein sequence] |
AVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENL YNDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKER EEWAKK |
|
PDB | 7dgq A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex. |
Chain | A2 |
Resolution | 5.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
UQ2 |
A2 |
S10 R11 R17 |
S6 R7 R13 |
|
|
|
|