Structure of PDB 6zvk Chain A2

Receptor sequence

>6zvkA2 (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

PDB

6zvk The Halastavi arva Virus Intergenic Region IRES Promotes Translation by the Simplest Possible Initiation Mechanism.

Chain

Resolution

3.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A2	R70 K74 Y78 K79 K87 R94 K97 K106 R109 K110 R112	R69 K73 Y77 K78 K86 R93 K96 K105 R108 K109 R111
BS02	rna	A2	K3 K5 R7 L44 S45 I47 R48 R51 K52 A55 R56 L58 T59 N62 Q63 R70 L81 K86 T88 R89 R92	K2 K4 R6 L43 S44 I46 R47 R50 K51 A54 R55 L57 T58 N61 Q62 R69 L80 K85 T87 R88 R91

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zvk, PDBe:6zvk, PDBj:6zvk
PDBsum	6zvk
PubMed	33296660
UniProt	G1SIT5\|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)