Structure of PDB 6nu2 Chain A2

Receptor sequence
>6nu2A2 (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]
ATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSV
MMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLP
NKLNKLLQRFPNKPYL
3D structure
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
ChainA2
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A2 A2 P4 S5 R9 A11 R12 F13 R17 K18 P19 V20 R32 V33 G34 R36 R37 R38 E39 K85 S98 L99 L104 Q109 R110 P112 A1 P3 S4 R8 A10 R11 F12 R16 K17 P18 V19 R31 V32 G33 R35 R36 R37 E38 K84 S97 L98 L103 Q108 R109 P111
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005763 mitochondrial small ribosomal subunit
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtQ96BP2|CHCH1_HUMAN Small ribosomal subunit protein mS37 (Gene Name=CHCHD1)

[Back to BioLiP]