Structure of PDB 8ove Chain A1

Receptor sequence

>8oveA1 (length=260) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

AKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECLSLLIIIRNRLKY
ALNALEAQMILRQGLVCVDGKPRKDGKYPAGFMDVVEIPKTGDRFRILYD
VKGRFALVRVSEAESSIKMMKVVNVYTGTGRIPVAVTHDGHRIRYPDPRT
SRGDTLVYDVKEKKVLDLIKIGNGKVVMVTGGANRGRIGEIVSIERHPGA
FDIARLKDASGHEFATRATNIFVIGKDMSSVPVTLPKQQGLRINVIQERE
EKLIAAETRR

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A1	A2 K3 K4 H5 K7 L9 K13 M16 S18 K19 V23 F24 A25 P26 R27 R29 A30 G31 R46 A55 M60 R63 Q64 R74 K78 K103 R105 Y127 T128 G129 T130 G131 R132 H142 R143 R145 R150 R153 L169 I170 K171 K176 G183 H198 G200 V246 R250	A1 K2 K3 H4 K6 L8 K12 M15 S17 K18 V22 F23 A24 P25 R26 R28 A29 G30 R45 A54 M59 R62 Q63 R73 K77 K102 R104 Y126 T127 G128 T129 G130 R131 H141 R142 R144 R149 R152 L168 I169 K170 K175 G182 H197 G199 V245 R249

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q386F2

[Back to BioLiP]