Structure of PDB 8ova Chain A1

Receptor sequence

>8ovaA1 (length=262) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

AKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECLSLLIIIRNRLKY
ALNALEAQMILRQGLVCVDGKPRKDGKYPAGFMDVVEIPKTGDRFRILYD
VKGRFALVRVSEAESSIKMMKVVNVYTGTGRIPVAVTHDGHRIRYPDPRT
SRGDTLVYDVKEKKVLDLIKIGNGKVVMVTGGANRGRIGEIVSIERHPGA
FDIARLKDASGHEFATRATNIFVIGKDMSSVPVTLPKQQGLRINVIQERE
EKLIAAETRRTT

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A1	A2 K4 H5 K7 L9 Y10 K13 M16 S18 K19 F24 R27 A30 G31 K34 R46 Q59 R63 Q64 K72 K78 K103 R105 N125 G129 T130 R132 R143 R145 L169 K171 G183 H198 G200 R218 K238 V246 E249 R250 R260	A1 K3 H4 K6 L8 Y9 K12 M15 S17 K18 F23 R26 A29 G30 K33 R45 Q58 R62 Q63 K71 K77 K102 R104 N124 G128 T129 R131 R142 R144 L168 K170 G182 H197 G199 R217 K237 V245 E248 R249 R259

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q386F2

[Back to BioLiP]