Structure of PDB 7wfd Chain A1

Receptor sequence

>7wfdA1 (length=196) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

AHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPANLERYKESELIHCRWAM
LAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIE
FLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNG
RLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIPFN

3D structure

PDB

7wfd Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	A1	N79 Y83	N34 Y38
BS02	CHL	A1	H47 W48 P50 F66	H2 W3 P5 F21
BS03	CLA	A1	G64 D65 F66 F68 L73 G74 Y83 K84 E87 R196 L199	G19 D20 F21 F23 L28 G29 Y38 K39 E42 R151 L154
BS04	CLA	A1	R82 Y83 H90	R37 Y38 H45
BS05	CLA	A1	W93 L96 G100 P104 Y128	W48 L51 G55 P59 Y83
BS06	CLA	A1	W118 W135 I141 I144 E145	W73 W90 I96 I99 E100
BS07	CHL	A1	Q116 A119 A120 L142 E145	Q71 A74 A75 L97 E100
BS08	CLA	A1	R92 W93 F151 Q155 R156 E159 F172	R47 W48 F106 Q110 R111 E114 F127
BS09	CLA	A1	R82 E85 S86 I89 H90 I149 A150 E153 R156	R37 E40 S41 I44 H45 I104 A105 E108 R111
BS10	CLA	A1	R92 M95 Y167 P168 G169 F172 D173 Y177 L187 K188 E191 N194	R47 M50 Y122 P123 G124 F127 D128 Y132 L142 K143 E146 N149
BS11	CLA	A1	K190 K193 N194	K145 K148 N149
BS12	CLA	A1	K190 N194 L197	K145 N149 L152
BS13	CLA	A1	L200 G204 V207 Q208 Y212 H224 N232 I233	L155 G159 V162 Q163 Y167 H179 N187 I188
BS14	CLA	A1	H224 L225 P228 W229	H179 L180 P183 W184
BS15	CLA	A1	V237 I238 P239	V192 I193 P194

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0016168	chlorophyll binding
GO:0019904	protein domain specific binding
GO:0046872	metal ion binding

	Biological Process
GO:0009409	response to cold
GO:0009644	response to high light intensity
GO:0009645	response to low light intensity stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0009941	chloroplast envelope
GO:0010287	plastoglobule
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7wfd, PDBe:7wfd, PDBj:7wfd
PDBsum	7wfd
PubMed	35123031
UniProt	Q01667\|CAB6_ARATH Chlorophyll a-b binding protein 6, chloroplastic (Gene Name=LHCA1)

[Back to BioLiP]