Structure of PDB 4v7j Chain A1

Receptor sequence
>4v7jA1 (length=93) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL
3D structure
PDB4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
ChainA1
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A1 K3 K10 R11 V14 A15 N16 Q19 R20 K25 G29 V30 K32 K33 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 K69 R76 K92 K1 K8 R9 V12 A13 N14 Q17 R18 K23 G27 V28 K30 K31 T33 K37 R38 R39 Q40 Y41 P42 N43 Q45 R48 R50 R59 K67 R74 K90
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
PDBsum4v7j
PubMed20005802
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]