Structure of PDB 9pcy Chain A

Receptor sequence
>9pcyA (length=99) Species: 3885 (Phaseolus vulgaris) [Search protein sequence]
LEVLLGSGDGSLVFVPSEFSVPSGEKIVFKNNAGFPHNVVFDEDEIPAGV
DAVKISMPEEELLNAPGETYVVTLDTKGTYSFYCSPHQGAGMVGKVTVN
3D structure
PDB9pcy High-resolution solution structure of reduced French bean plastocyanin and comparison with the crystal structure of poplar plastocyanin.
ChainA
ResolutionN/A
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H37 C84 H87 M92
Catalytic site (residue number reindexed from 1) H37 C84 H87 M92
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H37 C84 H87 H37 C84 H87
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0009055 electron transfer activity
GO:0046028 electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity
GO:0046872 metal ion binding
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009543 chloroplast thylakoid lumen
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:9pcy, PDBe:9pcy, PDBj:9pcy
PDBsum9pcy
PubMed1920431
UniProtP00287|PLAS_PHAVU Plastocyanin (Gene Name=PETE)

[Back to BioLiP]