Structure of PDB 9mht Chain A

Receptor sequence

>9mhtA (length=327) Species: 726 (Haemophilus haemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 9mht Structures of HhaI methyltransferase complexed with substrates containing mismatches at the target base.
• Chain: A
• Resolution: 2.39 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y44 K234 G236 Q237 G257 S296	Y44 K234 G236 Q237 G257 S296
BS02	dna	A	S85 S87 G88 K89 R97 R165 R228 Q237 R240 Y242 T250 A253 Y254 G303	S85 S87 G88 K89 R97 R165 R228 Q237 R240 Y242 T250 A253 Y254 G303
BS03	SAH	A	F18 A19 G23 E40 W41 D60 G78 N304 S305	F18 A19 G23 E40 W41 D60 G78 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:9mht, PDBe:9mht, PDBj:9mht
• PDBsum: 9mht
• PubMed: 9783745
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)