Structure of PDB 9f4y Chain A |
>9f4yA (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] |
PKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG FGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSHLTVKKIFVGGIKED TEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ KYHTVNGHNCEVRKAL |
|
PDB | 9f4y Enhanced identification of small molecules binding to hnRNP A1 via in silico hotspot and cryptic pockets mapping coupled with X-Ray fragment screening |
Chain | A |
Resolution | 1.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
W0S |
A |
F17 F57 K87 H101 |
F11 F51 K81 H86 |
|
|
|
|