Structure of PDB 9cj0 Chain A

Receptor sequence

>9cj0A (length=170) Species: 7757 (Petromyzon marinus)

GHACPSQCSCDQTTVKCHSRRLTSVPAGIPTTTKILRLYSNQITKLEPGV
FDHLVNLEKLYISWNQLSALPVGVFDKLTKLTHLSLGYNQLKSVPRGAFD
NLKSLTHIWLLNNPWDCECSDILYLKNWIVQHASIVNLQGHGGVDNVKCS
GTNTPVRAVTEASTSPSKCP

3D structure

• PDB: 9cj0 The High-Resolution Structure of a Variable Lymphocyte Receptor from Petrozymon marinus Capable of Binding to the Brain Extracellular Matrix
• Chain: A
• Resolution: 1.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EP1	A	S61 W107 Q137 H139	S63 W109 Q139 H141

External links

• PDB: RCSB:9cj0, PDBe:9cj0, PDBj:9cj0
• PDBsum: 9cj0