Structure of PDB 9c66 Chain A |
>9c66A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGR KIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFA SAMMHALEVLNS |
|
PDB | 9c66 Insights into the Interaction Landscape of the EVH1 Domain of Mena. |
Chain | A |
Resolution | 1.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
Y16 W23 F77 Q79 |
Y15 W22 F76 Q78 |
|
|
|