Structure of PDB 9bk8 Chain A |
>9bk8A (length=116) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
MEPTRIATNDRLSAAVCFDALVFLSGQVPGQAEDIHGQTREVLAKIDALL AEAGSRKERILSATIYLKDIARDFAALNEVWTQWLPTGQAPSRTTVQAEL ARPSVLVEITVVAARG |
|
PDB | 9bk8 Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa with 2-ketobutyric acid bound |
Chain | A |
Resolution | 1.67 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2KT |
A |
R93 T94 T95 |
R93 T94 T95 |
|
|
|