Structure of PDB 9b4g Chain A

Receptor sequence

>9b4gA (length=388) Species: 9606 (Homo sapiens) [Search protein sequence]

KDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTRD
DSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLY
FLFLVFLLFLNFEQVKSLMYWLDPNLRYATNCHVITWERIISHFDIFAFG
HFWGWAMKALLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILD
ILLCNGGGIWLGMVVCRFLEMRTYHWASFKDIHTTTGKIKRAVLQFTPAS
WTYVRWFDPKSSFQRVAGVYLFMIIWQLTELNTFFLKHIFVFQASHPLSW
GRILFIGGITAPTVRQYYAYLTDTQCKRVGTQCWVFGVIGFLEAIVCIKF
GQDLFSKTQILYVVLWLLCVAFTTFLCLYGMIWYAEHY

3D structure

PDB

9b4g Molecular insights into human phosphatidylserine synthase 1 reveal its inhibition promotes LDL uptake.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	P5S	A	F93 T94 R95 M178 F267 T268 P269 A270 S271 W272 T273 G329 R336	F82 T83 R84 M157 F246 T247 P248 A249 S250 W251 T252 G308 R315
BS02	P5S	A	E30 D31 T33 F37 R95 P96 Q266	E19 D20 T22 F26 R84 P85 Q245
BS03	LBN	A	Q285 F293 W297 Y341 C347 K348 C354 F357 G358 V385	Q264 F272 W276 Y320 C326 K327 C333 F336 G337 V364
BS04	A1AIS	A	E26 F37 R39 P40 L45 L86 A87 R102	E15 F26 R28 P29 L34 L75 A76 R91
BS05	6OU	A	F168 G171 H172 W174 M178 I324 L325	F147 G150 H151 W153 M157 I303 L304
BS06	CA	A	E197 E200 Q217 D221	E176 E179 Q196 D200
BS07	A1AIT	A	L110 F114 M130 L133 D134 L307 F313 H317 L319 S320 R323	L99 F103 M119 L122 D123 L286 F292 H296 L298 S299 R302
BS08	LBN	A	P40 H41 T42 I43 T44 S47 I50	P29 H30 T31 I32 T33 S36 I39
BS09	LBN	A	Y341 K348 R349 V350	Y320 K327 R328 V329

External links

PDB	RCSB:9b4g, PDBe:9b4g, PDBj:9b4g
PDBsum	9b4g
PubMed	39208797
UniProt	P48651\|PTSS1_HUMAN Phosphatidylserine synthase 1 (Gene Name=PTDSS1)

[Back to BioLiP]