Structure of PDB 9b0b Chain A |
>9b0bA (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] |
RAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQME VYSEDFHAERAAREKIHEEKEQLALQLAVLLKEND |
|
PDB | 9b0b Linkage and substrate specificity conferred by NZF ubiquitin binding domains |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
K429 K440 |
K10 K21 |
|
|
|