Structure of PDB 9azj Chain A |
>9azjA (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] |
QLEDLKQQLQQAEEALVAKQEVIDKLCEEAEQHKIVMETVPVLKAQADIY KADFQAERQAREKLAEKKELLQEQLEQLQREYSKL |
|
PDB | 9azj Structure of TAB2 NZF domain bound to K6 / Lys6-linked diubiquitin |
Chain | A |
Resolution | 3.32 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
Q266 K277 |
Q8 K19 |
|
|
|