Structure of PDB 8zha Chain A |
>8zhaA (length=143) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] |
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLA GRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPSMNKELKKII GQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ |
|
PDB | 8zha Design and synthesis of novel and potent allosteric HIV-1 integrase inhibitors with a spirocyclic moiety. |
Chain | A |
Resolution | 1.95 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
A1L1W |
A |
T124 T125 A128 |
T69 T70 A73 |
|
|
|